PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096324.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 291aa    MW: 31650.5 Da    PI: 10.2194
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096324.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.52.9e-3849107361
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        +kcprCds+ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rk k+ 
  XP_011096324.1  49 PPPQKCPRCDSSNTKFCYYNNYSLSQPRYFCKGCRRYWTQGGTLRNVPVGGGCRKTKRP 107
                     56789**************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088429.05952106IPR003851Zinc finger, Dof-type
PfamPF027019.6E-3352106IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2553106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MQFMQSNMEQ RRNEEKLLKQ QQDQQQPPSR RLKPAEMQMA AAHNQHQPPP PQKCPRCDSS  60
NTKFCYYNNY SLSQPRYFCK GCRRYWTQGG TLRNVPVGGG CRKTKRPKPS IPSSSSSEIA  120
RTQSLSPALP SQNLTGMISG SALRALPSVI PSVGHSNFYT GGAFMSSLAS MQSLPAGINQ  180
GVALNLGGGG QYGVSMALLQ GINVLPTMKP QEPQQLLQND FFQPHQSLTI PPRPSLSSWT  240
QGFLSRGTAS SSTASPSFWM GTAADGGNQG SSSFNPNHWS SDNHPGFDPS Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096323.10.0PREDICTED: dof zinc finger protein DOF3.1-like isoform X1
RefseqXP_011096324.10.0PREDICTED: dof zinc finger protein DOF3.1-like isoform X1
RefseqXP_011096325.10.0PREDICTED: dof zinc finger protein DOF3.1-like isoform X1
TrEMBLA0A022QL731e-83A0A022QL73_ERYGU; Uncharacterized protein
STRINGVIT_10s0003g00030.t012e-42(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.16e-33TARGET OF MONOPTEROS 6